Neurexophilin 4 antibody (N-Term)

Catalog No. ABIN632622

Product Details anti-Neurexophilin 4 Antibody

Target: Neurexophilin 4 (NXPH4)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Neurexophilin 4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Neurexophilin 4 antibody was raised against the N terminal of NXPH4

Purification: Affinity purified

Immunogen: Neurexophilin 4 antibody was raised using the N terminal of NXPH4 corresponding to a region with amino acids MRLLPEWFLLLFGPWLLRKAVSAQIPESGRPQYLGLRPAAAGAGAPGQQL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Neurexophilin 4 Blocking Peptide, catalog no. 33R-6369, is also available for use as a blocking control in assays to test for specificity of this Neurexophilin 4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NXPH4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Neurexophilin 4

Target: Neurexophilin 4 (NXPH4)

Alternative Name: Neurexophilin 4 (NXPH4 Products)

Background: NXPH4 may be signaling molecules that resemble neuropeptides and that act by binding to alpha-neurexins and possibly other receptors.

Molecular Weight: 34 kDa (MW of target protein)