SPATA24 antibody (C-Term)

Catalog No. ABIN632623

Product Details anti-SPATA24 Antibody

Target: SPATA24 (Spermatogenesis Associated 24 (SPATA24))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SPATA24 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SPATA24 antibody was raised against the c terminal of SPATA24

Purification: Affinity purified

Immunogen: SPATA24 antibody was raised using the C terminal of SPATA24 corresponding to a region with amino acids LQQVISQQKQIFRNHMSDFRIQKQQESYMAQVLDQKHKKASGTRQARSHQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SPATA24 Blocking Peptide, catalog no. 33R-5332, is also available for use as a blocking control in assays to test for specificity of this SPATA24 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SPATA24

Target: SPATA24 (Spermatogenesis Associated 24 (SPATA24))

Alternative Name: SPATA24 (SPATA24 Products)

Synonyms: CCDC161 antibody, T6441 antibody, 2700012K08Rik antibody, 4930583E11Rik antibody, 5133400G04Rik antibody, AU016220 antibody, TIPT antibody, TIPT2 antibody, RGD1311742 antibody, spermatogenesis associated 24 antibody, SPATA24 antibody, Spata24 antibody

Background: SPATA24 binds DNA with high affinity but does not bind to TATA boxes.SPATA24 synergises with GMNN and TBP in activation of TATA box-containing promoters and with GMNN and TBPL1 in activation of the NF1 TATA-less promoter.

Molecular Weight: 23 kDa (MW of target protein)