MAT2A antibody (Middle Region)

Catalog No. ABIN632627

Product Details anti-MAT2A Antibody

Target: MAT2A (Methionine Adenosyltransferase II, alpha (MAT2A))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAT2A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MAT2 A antibody was raised against the middle region of MAT2

Purification: Affinity purified

Immunogen: MAT2 A antibody was raised using the middle region of MAT2 corresponding to a region with amino acids LLEIVKKNFDLRPGVIVRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAT2A Blocking Peptide, catalog no. 33R-5128, is also available for use as a blocking control in assays to test for specificity of this MAT2A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAT2A

Target: MAT2A (Methionine Adenosyltransferase II, alpha (MAT2A))

Alternative Name: MAT2A (MAT2A Products)

Synonyms: MATA2 antibody, MATII antibody, SAMS2 antibody, Sams2 antibody, D630045P18Rik antibody, fd12a12 antibody, mat2a antibody, si:ch73-340n8.1 antibody, wu:fb95e01 antibody, wu:fd12a12 antibody, m(2)21ab antibody, MGC76253 antibody, MGC79598 antibody, zgc:110847 antibody, methionine adenosyltransferase 2A antibody, methionine adenosyltransferase II, alpha antibody, methionine adenosyltransferase II, alpha a antibody, methionine adenosyltransferase II, alpha L homeolog antibody, methionine adenosyltransferase II, alpha b antibody, MAT2A antibody, Mat2a antibody, mat2aa antibody, mat2a.L antibody, mat2a antibody, mat2ab antibody

Background: MAT2A catalyzes the formation of S-adenosylmethionine from methionine and ATP.

Molecular Weight: 44 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, Methionine Biosynthetic Process