TOM1 antibody

Catalog No. ABIN632634

Product Details anti-TOM1 Antibody

Target: TOM1 (Target of Myb 1 (TOM1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TOM1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: TOM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TOM1 Blocking Peptide, catalog no. 33R-8487, is also available for use as a blocking control in assays to test for specificity of this TOM1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TOM1

Target: TOM1 (Target of Myb 1 (TOM1))

Alternative Name: TOM1 (TOM1 Products)

Synonyms: TOM-1B antibody, tom-1A antibody, target of myb1 membrane trafficking protein antibody, target of myb1 trafficking protein antibody, TOM1 antibody, Tom1 antibody

Background: This gene was identified as a target of the v-myb oncogene. The encoded protein shares its N-terminal domain in common with proteins associated with vesicular trafficking at the endosome. It is recruited to the endosomes by its interaction with endofin. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 54 kDa (MW of target protein)