TOM1 antibody
-
- Target See all TOM1 Antibodies
- TOM1 (Target of Myb 1 (TOM1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TOM1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- TOM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGA
- Top Product
- Discover our top product TOM1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TOM1 Blocking Peptide, catalog no. 33R-8487, is also available for use as a blocking control in assays to test for specificity of this TOM1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOM1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TOM1 (Target of Myb 1 (TOM1))
- Alternative Name
- TOM1 (TOM1 Products)
- Synonyms
- TOM-1B antibody, tom-1A antibody, target of myb1 membrane trafficking protein antibody, target of myb1 trafficking protein antibody, TOM1 antibody, Tom1 antibody
- Background
- This gene was identified as a target of the v-myb oncogene. The encoded protein shares its N-terminal domain in common with proteins associated with vesicular trafficking at the endosome. It is recruited to the endosomes by its interaction with endofin. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Molecular Weight
- 54 kDa (MW of target protein)
-