ADSSL1 antibody (Middle Region)

Catalog No. ABIN632681

Product Details anti-ADSSL1 Antibody

Target: ADSSL1 (Adenylosuccinate Synthase Like 1 (ADSSL1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADSSL1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ADSSL1 antibody was raised against the middle region of ADSSL1

Purification: Affinity purified

Immunogen: ADSSL1 antibody was raised using the middle region of ADSSL1 corresponding to a region with amino acids VDGLQEVQRQAQEGKNIGTTKKGIGPTYSSKAARTGLRICDLLSDFDEFS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADSSL1 Blocking Peptide, catalog no. 33R-9461, is also available for use as a blocking control in assays to test for specificity of this ADSSL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADSSL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADSSL1

Target: ADSSL1 (Adenylosuccinate Synthase Like 1 (ADSSL1))

Alternative Name: ADSSL1 (ADSSL1 Products)

Synonyms: AdSS 1 antibody, zgc:85738 antibody, adss1-b antibody, adss1 antibody, adss1-a antibody, adssl1 antibody, ADSS1 antibody, AI528595 antibody, Adss antibody, Adss1 antibody, adss1a antibody, adssl1a antibody, adenylosuccinate synthase like 1 antibody, adenylosuccinate synthase like 1 S homeolog antibody, adenylosuccinate synthase like 1 L homeolog antibody, inverted formin-2 antibody, adenylosuccinate synthetase like 1 antibody, Adenylosuccinate synthetase isozyme 1 antibody, ADSSL1 antibody, adssl1 antibody, adssl1.S antibody, adssl1.L antibody, LOC100061064 antibody, Adssl1 antibody, pura1 antibody

Background: ADSSL1 is a muscle isozyme of adenylosuccinate synthase (EC 6.3.4.4), which catalyzes the initial reaction in the conversion of inosine monophosphate (IMP) to adenosine monophosphate (AMP).

Molecular Weight: 50 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process