C11ORF74 antibody (Middle Region)

Catalog No. ABIN632721

Product Details anti-C11ORF74 Antibody

Target: C11ORF74 (Chromosome 11 Open Reading Frame 74 (C11ORF74))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C11ORF74 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C11 ORF74 antibody was raised against the middle region of C11 rf74

Purification: Affinity purified

Immunogen: C11 ORF74 antibody was raised using the middle region of C11 rf74 corresponding to a region with amino acids VQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRKDTSPDLEKSCD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C11ORF74 Blocking Peptide, catalog no. 33R-9749, is also available for use as a blocking control in assays to test for specificity of this C11ORF74 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF74 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C11ORF74

Target: C11ORF74 (Chromosome 11 Open Reading Frame 74 (C11ORF74))

Alternative Name: C11ORF74 (C11ORF74 Products)

Synonyms: HEPIS antibody, chromosome 11 open reading frame 74 antibody, chromosome 5 C11orf74 homolog antibody, C11orf74 antibody, C5H11orf74 antibody, c11orf74 antibody

Background: The function of C11orf74 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 25 kDa (MW of target protein)