ARL13B antibody (Middle Region)

Catalog No. ABIN632725

Product Details anti-ARL13B Antibody

Target: ARL13B (ADP-Ribosylation Factor-Like 13B (ARL13B))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARL13B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ARL13 B antibody was raised against the middle region of ARL13

Purification: Affinity purified

Immunogen: ARL13 B antibody was raised using the middle region of ARL13 corresponding to a region with amino acids VEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARL13B Blocking Peptide, catalog no. 33R-9507, is also available for use as a blocking control in assays to test for specificity of this ARL13B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARL13B

Target: ARL13B (ADP-Ribosylation Factor-Like 13B (ARL13B))

Alternative Name: ARL13B (ARL13B Products)

Synonyms: ARL2L1 antibody, MGC185757 antibody, arl2l1 antibody, chunp6872 antibody, fc23g07 antibody, wu:fc23g07 antibody, zgc:123149 antibody, JBTS8 antibody, A530097K21Rik antibody, A930014M17Rik antibody, Arl2l1 antibody, C530009C10Rik antibody, hnn antibody, ADP-ribosylation factor like GTPase 13B antibody, ADP ribosylation factor like GTPase 13B antibody, ADP-ribosylation factor-like 13b antibody, ADP-ribosylation factor-like 13B antibody, Arl13b antibody, ARL13B antibody, arl13b antibody

Background: ARL13B has an evolutionarily conserved role mediating cilia function in multiple organs. N and C domains of ARL13B cooperatively regulate its ciliary localization and that N domain-dependent self-association of Arl13b may be important for its function in cilia biogenesis.

Molecular Weight: 36 kDa (MW of target protein)