C4ORF23 antibody (N-Term)

Catalog No. ABIN632740

Product Details anti-C4ORF23 Antibody

Target: C4ORF23 (METTL19) (Methyltransferase Like 19 (METTL19))

Binding Specificity: N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C4ORF23 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C4 ORF23 antibody was raised against the N terminal Of C4 rf23

Purification: Affinity purified

Immunogen: C4 ORF23 antibody was raised using the N terminal Of C4 rf23 corresponding to a region with amino acids LTPWIPVIAARSSYNCRFFVLPCCFFDFIGRYSRRQSKKTQYREYLDFIK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C4ORF23 Blocking Peptide, catalog no. 33R-5486, is also available for use as a blocking control in assays to test for specificity of this C4ORF23 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF23 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C4ORF23

Target: C4ORF23 (METTL19) (Methyltransferase Like 19 (METTL19))

Alternative Name: C4ORF23 (METTL19 Products)

Synonyms: C4orf23 antibody, 2310079F23Rik antibody, Mettl19 antibody, c4orf23 antibody, mettl19 antibody, METTL19 antibody, TRM44 antibody, tRNA methyltransferase 44 homolog (S. cerevisiae) antibody, tRNA methyltransferase 44 antibody, tRNA methyltransferase 44 homolog L homeolog antibody, tRNA methyltransferase 44 homolog antibody, TRMT44 antibody, Trmt44 antibody, trmt44.L antibody

Background: The function of Chromosome 4 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 41 kDa (MW of target protein)