CPNE9 antibody (Middle Region)
-
- Target See all CPNE9 Antibodies
- CPNE9 (Copine IX (CPNE9))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CPNE9 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Copine IX antibody was raised against the middle region of CPNE9
- Purification
- Affinity purified
- Immunogen
- Copine IX antibody was raised using the middle region of CPNE9 corresponding to a region with amino acids YDRTVKIDVYDWDRDGSHDFIGEFTTSYRELSKAQNQFTVYEVLNPRKKC
- Top Product
- Discover our top product CPNE9 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Copine IX Blocking Peptide, catalog no. 33R-10075, is also available for use as a blocking control in assays to test for specificity of this Copine IX antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPNE9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CPNE9 (Copine IX (CPNE9))
- Alternative Name
- Copine IX (CPNE9 Products)
- Synonyms
- A730016F12Rik antibody, mKIAA4217 antibody, RGD1309212 antibody, copine family member 9 antibody, copine family member IX antibody, CPNE9 antibody, Cpne9 antibody
- Background
- CPNE9 may function in membrane trafficking. It exhibits calcium-dependent phospholipid binding properties.
- Molecular Weight
- 62 kDa (MW of target protein)
-