RAB3IP antibody

Catalog No. ABIN632769

Product Details anti-RAB3IP Antibody

Target: RAB3IP (RAB3A Interacting Protein (Rabin3) (RAB3IP))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB3IP antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RAB3 IP antibody was raised using a synthetic peptide corresponding to a region with amino acids APCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAB3IP Blocking Peptide, catalog no. 33R-1417, is also available for use as a blocking control in assays to test for specificity of this RAB3IP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAB3IP

Target: RAB3IP (RAB3A Interacting Protein (Rabin3) (RAB3IP))

Alternative Name: RAB3IP (RAB3IP Products)

Synonyms: rabin3 antibody, gtpat12 antibody, MGC64583 antibody, MGC75737 antibody, MGC82752 antibody, zgc:110270 antibody, DKFZp469A0532 antibody, DKFZp469O1131 antibody, RABIN3 antibody, B230311A06 antibody, Gtpat12 antibody, Rabin3 antibody, RAB3A interacting protein L homeolog antibody, RAB3A interacting protein antibody, RAB3A interacting protein (rabin3) antibody, rab3ip.L antibody, rab3ip antibody, RAB3IP antibody, Rab3ip antibody

Background: The function of RAB3A protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 53 kDa (MW of target protein)