AKR7A3 antibody
-
- Target See all AKR7A3 Antibodies
- AKR7A3 (Aldo-Keto Reductase Family 7, Member A3 (Aflatoxin Aldehyde Reductase) (AKR7A3))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This AKR7A3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- AKR7 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTW
- Top Product
- Discover our top product AKR7A3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
AKR7A3 Blocking Peptide, catalog no. 33R-9513, is also available for use as a blocking control in assays to test for specificity of this AKR7A3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKR0 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AKR7A3 (Aldo-Keto Reductase Family 7, Member A3 (Aflatoxin Aldehyde Reductase) (AKR7A3))
- Alternative Name
- AKR7A3 (AKR7A3 Products)
- Synonyms
- AFAR2 antibody, fd56g11 antibody, wu:fd56g11 antibody, zgc:92502 antibody, AKR7A2 antibody, Afar antibody, Akr7a1 antibody, aldo-keto reductase family 7 member A3 antibody, aldo-keto reductase family 7, member A3 (aflatoxin aldehyde reductase) antibody, aflatoxin B1 aldehyde reductase member 3 antibody, AKR7A3 antibody, akr7a3 antibody, LOC788425 antibody, Akr7a3 antibody
- Background
- Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones.
- Molecular Weight
- 37 kDa (MW of target protein)
-