BRISC and BRCA1 A Complex Member 1 (BABAM1) (N-Term) antibody

Catalog No. ABIN632802

Product Details

Target: BRISC and BRCA1 A Complex Member 1 (BABAM1)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Specificity: C19 ORF62 antibody was raised against the N terminal Of C19 rf62

Purification: Affinity purified

Immunogen: C19 ORF62 antibody was raised using the N terminal Of C19 rf62 corresponding to a region with amino acids DRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C19ORF62 Blocking Peptide, catalog no. 33R-2140, is also available for use as a blocking control in assays to test for specificity of this C19ORF62 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF62 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: BRISC and BRCA1 A Complex Member 1 (BABAM1)

Alternative Name: C19ORF62 (BABAM1 Products)

Synonyms: merit40 antibody, nba1 antibody, zgc:100909 antibody, c19orf62 antibody, C19orf62 antibody, MERIT40 antibody, NBA1 antibody, C7H19orf62 antibody, 5430437P03Rik antibody, Merit40 antibody, BRISC and BRCA1 A complex member 1 antibody, BRISC and BRCA1 A complex member 1 L homeolog antibody, babam1 antibody, BABAM1 antibody, babam1.L antibody, Babam1 antibody

Background: C19orf62 is a component of the BRCA1-A complex, a complex that specifically recognises 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs).

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Positive Regulation of Response to DNA Damage Stimulus