SMG5 antibody
-
- Target See all SMG5 Antibodies
- SMG5 (Smg-5 Homolog, Nonsense Mediated mRNA Decay Factor (SMG5))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SMG5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SMG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSQGPPTGESSEPEAKVLHTKRLYRAVVEAVHRLDLILCNKTAYQEVFKP
- Top Product
- Discover our top product SMG5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SMG5 Blocking Peptide, catalog no. 33R-6479, is also available for use as a blocking control in assays to test for specificity of this SMG5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMG5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SMG5 (Smg-5 Homolog, Nonsense Mediated mRNA Decay Factor (SMG5))
- Alternative Name
- SMG5 (SMG5 Products)
- Synonyms
- BC024683 antibody, mKIAA1089 antibody, EST1B antibody, LPTS-RP1 antibody, LPTSRP1 antibody, SMG-5 antibody, SMG5, nonsense mediated mRNA decay factor antibody, Smg-5 homolog, nonsense mediated mRNA decay factor (C. elegans) antibody, SMG5 nonsense mediated mRNA decay factor antibody, SMG5 antibody, Smg5 antibody
- Background
- SMG5 plays a role in nonsense-mediated mRNA decay. SMG5 does not have RNase activity by itself. SMG5 promotes dephosphorylation of RENT1. SMG5 is necessary for TERT activity.
- Molecular Weight
- 114 kDa (MW of target protein)
-