HARBI1 antibody (Middle Region)
-
- Target See all HARBI1 Antibodies
- HARBI1 (Harbinger Transposase Derived 1 (HARBI1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Mouse, Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HARBI1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C11 ORF77 antibody was raised against the middle region of C11 rf77
- Purification
- Affinity purified
- Immunogen
- C11 ORF77 antibody was raised using the middle region of C11 rf77 corresponding to a region with amino acids GVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETN
- Top Product
- Discover our top product HARBI1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C11ORF77 Blocking Peptide, catalog no. 33R-3645, is also available for use as a blocking control in assays to test for specificity of this C11ORF77 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF77 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HARBI1 (Harbinger Transposase Derived 1 (HARBI1))
- Alternative Name
- C11ORF77 (HARBI1 Products)
- Synonyms
- C11orf77 antibody, C15H11orf77 antibody, D230010M03Rik antibody, flj32675 antibody, zgc:91866 antibody, harbinger transposase derived 1 antibody, HARBI1 antibody, Harbi1 antibody, harbi1 antibody
- Background
- The function of Chromosome 11 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 39 kDa (MW of target protein)
-