GANC antibody (Middle Region)

Catalog No. ABIN632846

Product Details anti-GANC Antibody

Target: GANC (Glucosidase, Alpha, Neutral C (GANC))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GANC antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GANC antibody was raised against the middle region of GANC

Purification: Affinity purified

Immunogen: GANC antibody was raised using the middle region of GANC corresponding to a region with amino acids VLGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSILSLEKLSLNIATDWEVR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GANC Blocking Peptide, catalog no. 33R-9658, is also available for use as a blocking control in assays to test for specificity of this GANC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GANC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GANC

Target: GANC (Glucosidase, Alpha, Neutral C (GANC))

Alternative Name: GANC (GANC Products)

Synonyms: 5830445O15Rik antibody, 9330160A12 antibody, mFLJ00088 antibody, glucosidase alpha, neutral C antibody, calpain-3 antibody, glucosidase, alpha; neutral C antibody, GANC antibody, LOC453361 antibody, ganc antibody, Ganc antibody

Background: GANC has alpha-glucosidase activity.Glycosyl hydrolase enzymes hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety.

Molecular Weight: 104 kDa (MW of target protein)