Chromosome 1 Open Reading Frame 190 (C1orf190) (Middle Region) antibody

Catalog No. ABIN632875

Product Details

Target: Chromosome 1 Open Reading Frame 190 (C1orf190)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Specificity: C1 ORF190 antibody was raised against the middle region of C1 rf190

Purification: Affinity purified

Immunogen: C1 ORF190 antibody was raised using the middle region of C1 rf190 corresponding to a region with amino acids SIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C1ORF190 Blocking Peptide, catalog no. 33R-8527, is also available for use as a blocking control in assays to test for specificity of this C1ORF190 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF190 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Chromosome 1 Open Reading Frame 190 (C1orf190)

Alternative Name: C1ORF190 (C1orf190 Products)

Synonyms: C8H1orf190 antibody, C1orf190 antibody, LRAP35a antibody, LRP35A antibody, Lrp35a antibody, RGD1566001 antibody, 1520402A15Rik antibody, leucine rich adaptor protein 1 antibody, LURAP1 antibody, lurap1 antibody, Lurap1 antibody

Background: The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 26 kDa (MW of target protein)