CUTC antibody

Catalog No. ABIN632915

Product Details anti-CUTC Antibody

Target: CUTC (CutC Copper Transporter Homolog (CUTC))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CUTC antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CUTC antibody was raised using a synthetic peptide corresponding to a region with amino acids LEGLPLIKRLIEQAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSARST

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CUTC Blocking Peptide, catalog no. 33R-4899, is also available for use as a blocking control in assays to test for specificity of this CUTC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUTC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CUTC

Target: CUTC (CutC Copper Transporter Homolog (CUTC))

Alternative Name: CUTC (CUTC Products)

Synonyms: zgc:103406 antibody, RP11-483F11.3 antibody, 2310039I18Rik antibody, AI326282 antibody, CGI-32 antibody, cutC copper transporter antibody, cutC copper transporter homolog (E. coli) antibody, CUTC antibody, cutc antibody, Cutc antibody

Background: Members of the CUT family of copper transporters are associated with copper homeostasis and are involved in the uptake, storage, delivery, and efflux of copper.

Molecular Weight: 29 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis