SMU1 antibody

Catalog No. ABIN632943

Product Details anti-SMU1 Antibody

Target: SMU1 (Smu-1 Suppressor of Mec-8 and Unc-52 Homolog (SMU1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SMU1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SMU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KQTQPERYIHLENLLARSYFDPREAYPDGSSKEKRRAAIAQALAGEVSVV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SMU1 Blocking Peptide, catalog no. 33R-4615, is also available for use as a blocking control in assays to test for specificity of this SMU1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMU1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SMU1

Target: SMU1 (Smu-1 Suppressor of Mec-8 and Unc-52 Homolog (SMU1))

Alternative Name: SMU1 (SMU1 Products)

Synonyms: SMU1 antibody, BWD antibody, RP11-54K16.3 antibody, SMU-1 antibody, fSAP57 antibody, 2600001O03Rik antibody, 2610203K23Rik antibody, AB044414 antibody, AI845086 antibody, AW556129 antibody, Bwd antibody, Smu-1 antibody, zgc:56147 antibody, SMU1, DNA replication regulator and spliceosomal factor antibody, WD40 repeat-containing protein SMU1 antibody, smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) antibody, DNA replication regulator and spliceosomal factor antibody, SMU1, DNA replication regulator and spliceosomal factor a antibody, SMU1 antibody, LOC100180093 antibody, Smu1 antibody, smu1a antibody

Background: SMU1 acts a s a suppressor of mec-8 and unc-52 homolog.

Molecular Weight: 57 kDa (MW of target protein)