ZNF420 antibody (N-Term)

Catalog No. ABIN632987

Product Details anti-ZNF420 Antibody

Target: ZNF420 (Zinc Finger Protein 420 (ZNF420))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZNF420 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ZNF420 antibody was raised against the N terminal of ZNF420

Purification: Affinity purified

Immunogen: ZNF420 antibody was raised using the N terminal of ZNF420 corresponding to a region with amino acids LENYSNLVSLDLPSRCASKDLSPEKNTYETELSQWEMSDRLENCDLEESN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZNF420 Blocking Peptide, catalog no. 33R-4917, is also available for use as a blocking control in assays to test for specificity of this ZNF420 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF420 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZNF420

Target: ZNF420 (Zinc Finger Protein 420 (ZNF420))

Alternative Name: ZNF420 (ZNF420 Products)

Synonyms: APAK antibody, B230119D13 antibody, B230312I18Rik antibody, mszf59-1 antibody, mszf70 antibody, zinc finger protein 420 antibody, ZNF420 antibody, znf420 antibody, LOC713619 antibody, LOC100062389 antibody, LOC100346786 antibody, Zfp420 antibody

Background: ZNF420 contains 19 C2H2-type zinc fingers and 1 KRAB domain. ZNF420 may be involved in transcriptional regulation.

Molecular Weight: 80 kDa (MW of target protein)