ARC (Middle Region) antibody

Catalog No. ABIN632995

Product Details

Target: ARC

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Specificity: ARC antibody was raised against the middle region of ARC

Purification: Affinity purified

Immunogen: ARC antibody was raised using the middle region of ARC corresponding to a region with amino acids ELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARC Blocking Peptide, catalog no. 33R-2534, is also available for use as a blocking control in assays to test for specificity of this ARC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: ARC

Synonyms: activity regulated cytoskeleton associated protein antibody, Arc antibody

Background: ARC is required for consolidation of synaptic plasticity as well as formation of long-term memory. It regulates endocytosis of AMPA receptors in response to synaptic activity. The protein is also required for homeostatic synaptic scaling of AMPA receptors.

Molecular Weight: 45 kDa (MW of target protein)