Ribose 5-Phosphate Isomerase A (RPIA) antibody

Catalog No. ABIN632996

Product Details

Target: Ribose 5-Phosphate Isomerase A (RPIA)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RPIA antibody was raised using a synthetic peptide corresponding to a region with amino acids MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPIA Blocking Peptide, catalog no. 33R-6341, is also available for use as a blocking control in assays to test for specificity of this RPIA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPIA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Ribose 5-Phosphate Isomerase A (RPIA)

Alternative Name: RPIA (RPIA Products)

Synonyms: MGC83218 antibody, RPI antibody, zgc:103524 antibody, ribose 5-phosphate isomerase A L homeolog antibody, ribose-5-phosphate isomerase antibody, ribose 5-phosphate isomerase A antibody, ribose 5-phosphate isomerase A (ribose 5-phosphate epimerase) antibody, rpia.L antibody, LOC475755 antibody, RPIA antibody, MSP_RS04925 antibody, EAMY_RS20365 antibody, Rpia antibody, rpia antibody

Background: Defects in RPIA are the cause of ribose 5-phosphate isomerase deficiency. The exact function of RPIA remains unknown.

Molecular Weight: 33 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process, Ribonucleoside Biosynthetic Process