SDR16C5 antibody (Middle Region)

Catalog No. ABIN633013

Product Details anti-SDR16C5 Antibody

Target: SDR16C5 (RDHE2) (Epidermal Retinal Dehydrogenase 2 (RDHE2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SDR16C5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RDHE2 antibody was raised against the middle region of RDHE2

Purification: Affinity purified

Immunogen: RDHE2 antibody was raised using the middle region of RDHE2 corresponding to a region with amino acids AGLSGVNGLADYCASKFAAFGFAESVFVETFVQKQKGIKTTIVCPFFIKT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RDHE2 Blocking Peptide, catalog no. 33R-1208, is also available for use as a blocking control in assays to test for specificity of this RDHE2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDHE2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SDR16C5

Target: SDR16C5 (RDHE2) (Epidermal Retinal Dehydrogenase 2 (RDHE2))

Alternative Name: RDHE2 (RDHE2 Products)

Synonyms: RDH2 antibody, RDH-E2 antibody, RDHE2 antibody, Rdhe2 antibody, Scdr9 antibody, RGD1565999 antibody, rdhe2 antibody, sdr16c5 antibody, short chain dehydrogenase/reductase family 16C member 5 antibody, short chain dehydrogenase/reductase family 16C, member 5 antibody, short chain dehydrogenase/reductase family 16C member 5 L homeolog antibody, SDR16C5 antibody, Sdr16c5 antibody, sdr16c5.L antibody

Background: The specific function of RDHE2 is not yet known.

Molecular Weight: 34 kDa (MW of target protein)