PCGF1 antibody (Middle Region)

Catalog No. ABIN633027

The Rabbit Polyclonal anti-PCGF1 antibody (ABIN633027) specifically detects PCGF1 in WB. The antibody is reactive with Human samples.

Quick Overview for PCGF1 antibody (Middle Region) (ABIN633027)

Target: PCGF1 (Polycomb Group Ring Finger 1 (PCGF1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCGF1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PCGF1 Antibody

Binding Specificity: Middle Region

Specificity: PCGF1 antibody was raised against the middle region of PCGF1

Purification: Affinity purified

Immunogen: PCGF1 antibody was raised using the middle region of PCGF1 corresponding to a region with amino acids PALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCGF1 Blocking Peptide, (ABIN5615254), is also available for use as a blocking control in assays to test for specificity of this PCGF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCGF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCGF1

Target: PCGF1 (Polycomb Group Ring Finger 1 (PCGF1))

Alternative Name: PCGF1

Background: PCGF1 is a mammalian homolog of the Drosophila polycomb group genes, which act as transcriptional repressors to regulate anterior-posterior patterning in early embryonic development.

Molecular Weight: 30 kDa (MW of target protein)