MRPS6 antibody (Middle Region)
-
- Target See all MRPS6 Antibodies
- MRPS6 (Mitochondrial Ribosomal Protein S6 (MRPS6))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MRPS6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MRPS6 antibody was raised against the middle region of MRPS6
- Purification
- Affinity purified
- Immunogen
- MRPS6 antibody was raised using the middle region of MRPS6 corresponding to a region with amino acids VESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRK
- Top Product
- Discover our top product MRPS6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MRPS6 Blocking Peptide, catalog no. 33R-9511, is also available for use as a blocking control in assays to test for specificity of this MRPS6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPS6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MRPS6 (Mitochondrial Ribosomal Protein S6 (MRPS6))
- Alternative Name
- MRPS6 (MRPS6 Products)
- Synonyms
- C21orf101 antibody, MRP-S6 antibody, RPMS6 antibody, S6mt antibody, AW046321 antibody, BcDNA:RH10862 antibody, CG15016 antibody, Dmel\\CG15016 antibody, Mrps6 antibody, zgc:153390 antibody, mitochondrial ribosomal protein S6 antibody, MRPS6 antibody, Mrps6 antibody, mRpS6 antibody, mrps6 antibody
- Background
- Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology.
- Molecular Weight
- 14 kDa (MW of target protein)
-