TINAG antibody (Middle Region)

Catalog No. ABIN633037

Product Details anti-TINAG Antibody

Target: TINAG (Tubulointerstitial Nephritis Antigen (TINAG))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TINAG antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TINAG antibody was raised against the middle region of TINAG

Purification: Affinity purified

Immunogen: TINAG antibody was raised using the middle region of TINAG corresponding to a region with amino acids VAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWYLRKRG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TINAG Blocking Peptide, catalog no. 33R-9407, is also available for use as a blocking control in assays to test for specificity of this TINAG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TINAG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TINAG

Target: TINAG (Tubulointerstitial Nephritis Antigen (TINAG))

Alternative Name: TINAG (TINAG Products)

Synonyms: TIN-AG antibody, AI452335 antibody, TIN-ag antibody, tubulointerstitial nephritis antigen antibody, TINAG antibody, Tinag antibody

Background: TINAG is a basement membrane glycoprotein initially identified as a target of antibodies in some forms of immunologically mediated tubulointerstitial nephritis.

Molecular Weight: 54 kDa (MW of target protein)