ITLN2 antibody (Middle Region)

Catalog No. ABIN633069

Product Details anti-ITLN2 Antibody

Target: ITLN2 (Intelectin 2 (ITLN2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ITLN2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ITLN2 antibody was raised against the middle region of ITLN2

Purification: Affinity purified

Immunogen: ITLN2 antibody was raised using the middle region of ITLN2 corresponding to a region with amino acids TVGDRWSSQQGNKADYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ITLN2 Blocking Peptide, catalog no. 33R-9353, is also available for use as a blocking control in assays to test for specificity of this ITLN2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITLN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ITLN2

Target: ITLN2 (Intelectin 2 (ITLN2))

Alternative Name: ITLN2 (ITLN2 Products)

Synonyms: HL2 antibody, HL-2 antibody, hl2 antibody, hl-2 antibody, MGC80711 antibody, itln1 antibody, MGC186157 antibody, itln3 antibody, intelectin 2 antibody, intelectin 2 L homeolog antibody, ITLN2 antibody, itln2.L antibody, itln2 antibody

Background: ITLN2 may play a role in the defense system against pathogens.

Molecular Weight: 36 kDa (MW of target protein)