RHOJ antibody (Middle Region)
-
- Target See all RHOJ Antibodies
- RHOJ (Ras Homolog Gene Family, Member J (RHOJ))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RHOJ antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RHOJ antibody was raised against the middle region of RHOJ
- Purification
- Affinity purified
- Immunogen
- RHOJ antibody was raised using the middle region of RHOJ corresponding to a region with amino acids LGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELK
- Top Product
- Discover our top product RHOJ Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RHOJ Blocking Peptide, catalog no. 33R-4988, is also available for use as a blocking control in assays to test for specificity of this RHOJ antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOJ antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RHOJ (Ras Homolog Gene Family, Member J (RHOJ))
- Alternative Name
- RHOJ (RHOJ Products)
- Synonyms
- MGC83410 antibody, RHOJ antibody, si:dkey-100h21.1 antibody, arhj antibody, rasl7b antibody, tc10b antibody, ARHJ antibody, RASL7B antibody, TC10B antibody, TCL antibody, 1110005O19Rik antibody, AW210585 antibody, Arhj antibody, TC10L antibody, ras homolog family member J antibody, ras homolog family member J L homeolog antibody, RHOJ antibody, rhoj.L antibody, rhoj antibody, Rhoj antibody
- Background
- ARHJ belongs to the Rho family of small GTP-binding proteins. Rho proteins regulate the dynamic assembly of cytoskeletal components for several physiologic processes, such as cell proliferation and motility and the establishment of cell polarity. They are also involved in pathophysiologic process, such as cell transformation and metastasis.
- Molecular Weight
- 24 kDa (MW of target protein)
-