PRSS3 antibody (N-Term)

Catalog No. ABIN633109

Product Details anti-PRSS3 Antibody

Target: PRSS3 (Protease, serine, 3 (PRSS3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRSS3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRSS3 antibody was raised against the N terminal of PRSS3

Purification: Affinity purified

Immunogen: PRSS3 antibody was raised using the N terminal of PRSS3 corresponding to a region with amino acids VAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRSS3 Blocking Peptide, catalog no. 33R-9443, is also available for use as a blocking control in assays to test for specificity of this PRSS3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRSS3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRSS3

Target: PRSS3 (Protease, serine, 3 (PRSS3))

Alternative Name: PRSS3 (PRSS3 Products)

Synonyms: MTG antibody, PRSS4 antibody, T9 antibody, TRY3 antibody, TRY4 antibody, Try3 antibody, Tb antibody, prss3 antibody, protease, serine 3 antibody, trypsin-3 antibody, protease, serine, 3 antibody, trypsin III antibody, protease, serine 3 L homeolog antibody, PRSS3 antibody, CpipJ_CPIJ016105 antibody, Prss3 antibody, trp-iii antibody, prss3.L antibody

Background: This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is expressed in the brain and pancreas and is resistant to common trypsin inhibitors. It is active on peptide linkages involving the carboxyl group of lysine or arginine. This gene is localized to the locus of T cell receptor beta variable orphans on chromosome 9. Four transcript variants encoding different isoforms have been described for this gene.

Molecular Weight: 33 kDa (MW of target protein)