TACC3 antibody (Middle Region)

Catalog No. ABIN633120

Product Details anti-TACC3 Antibody

Target: TACC3 (Transforming, Acidic Coiled-Coil Containing Protein 3 (TACC3))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TACC3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TACC3 antibody was raised against the middle region of TACC3

Purification: Affinity purified

Immunogen: TACC3 antibody was raised using the middle region of TACC3 corresponding to a region with amino acids PGSEPVPTHQQGQPALELKEESFRDPAEVLGTGAEVDYLEQFGTSSFKES

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TACC3 Blocking Peptide, catalog no. 33R-7132, is also available for use as a blocking control in assays to test for specificity of this TACC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TACC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TACC3

Target: TACC3 (Transforming, Acidic Coiled-Coil Containing Protein 3 (TACC3))

Alternative Name: TACC3 (TACC3 Products)

Synonyms: Aint antibody, C86661 antibody, Eric1 antibody, ERIC-1 antibody, ERIC1 antibody, maskin antibody, masking antibody, xmaskin antibody, transforming, acidic coiled-coil containing protein 3 antibody, transforming acidic coiled-coil containing protein 3 antibody, transforming acidic coiled-coil containing protein 3 S homeolog antibody, Tacc3 antibody, TACC3 antibody, tacc3.S antibody

Background: The function of this gene has not yet been determined, however, it is speculated that it may be involved in cell growth and differentiation. Expression of this gene is up-regulated in some cancer cell lines, and in embryonic day 15 in mice.

Molecular Weight: 90 kDa (MW of target protein)

Pathways: Maintenance of Protein Location