ZDHHC21 antibody (Middle Region)
-
- Target See all ZDHHC21 Antibodies
- ZDHHC21 (Zinc Finger, DHHC-Type Containing 21 (ZDHHC21))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ZDHHC21 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ZDHHC21 antibody was raised against the middle region of ZDHHC21
- Purification
- Affinity purified
- Immunogen
- ZDHHC21 antibody was raised using the middle region of ZDHHC21 corresponding to a region with amino acids ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV
- Top Product
- Discover our top product ZDHHC21 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ZDHHC21 Blocking Peptide, catalog no. 33R-2559, is also available for use as a blocking control in assays to test for specificity of this ZDHHC21 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC21 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZDHHC21 (Zinc Finger, DHHC-Type Containing 21 (ZDHHC21))
- Alternative Name
- ZDHHC21 (ZDHHC21 Products)
- Synonyms
- 9130404H11Rik antibody, AL024349 antibody, D130004H04Rik antibody, dep antibody, DHHC-21 antibody, DHHC21 antibody, DNZ1 antibody, HSPC097 antibody, zinc finger DHHC-type containing 21 antibody, zinc finger, DHHC domain containing 21 antibody, zinc finger, DHHC-type containing 21 antibody, ZDHHC21 antibody, zdhhc21 antibody, Zdhhc21 antibody
- Background
- The function of ZDHHC21 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 31 kDa (MW of target protein)
-