FAM118A antibody (Middle Region)

Catalog No. ABIN633127

Product Details anti-FAM118A Antibody

Target: FAM118A (Family with Sequence Similarity 118, Member A (FAM118A))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM118A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM118 A antibody was raised against the middle region of FAM118

Purification: Affinity purified

Immunogen: FAM118 A antibody was raised using the middle region of FAM118 corresponding to a region with amino acids EVMEVLQNLYRTKSFLFVGCGETLRDQIFQALFLYSVPNKVDLEHYMLVL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM118A Blocking Peptide, catalog no. 33R-2802, is also available for use as a blocking control in assays to test for specificity of this FAM118A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM110 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM118A

Target: FAM118A (Family with Sequence Similarity 118, Member A (FAM118A))

Alternative Name: FAM118A (FAM118A Products)

Synonyms: C22orf8 antibody, 3110048E14Rik antibody, C230014M12Rik antibody, family with sequence similarity 118 member A antibody, family with sequence similarity 118, member A antibody, FAM118A antibody, Fam118a antibody

Background: The function of FAM118 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 40 kDa (MW of target protein)