PAGE4 antibody

Catalog No. ABIN633161

Product Details anti-PAGE4 Antibody

Target: PAGE4 (P Antigen Family, Member 4 (Prostate Associated) (PAGE4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PAGE4 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PAGE4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PAGE4 Blocking Peptide, catalog no. 33R-7259, is also available for use as a blocking control in assays to test for specificity of this PAGE4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAGE4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PAGE4

Target: PAGE4 (P Antigen Family, Member 4 (Prostate Associated) (PAGE4))

Alternative Name: PAGE4 (PAGE4 Products)

Synonyms: CT16.7 antibody, GAGE-9 antibody, GAGEC1 antibody, JM-27 antibody, PAGE-1 antibody, PAGE-4 antibody, PAGE family member 4 antibody, PAGE4 antibody

Background: This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer, but is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens.

Molecular Weight: 11 kDa (MW of target protein)