ADAMTS18 antibody (N-Term)

Catalog No. ABIN633175

Product Details anti-ADAMTS18 Antibody

Target: ADAMTS18 (ADAM Metallopeptidase with thrombospondin Type 1 Motif, 18 (ADAMTS18))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADAMTS18 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ADAMTS18 antibody was raised against the N terminal of ADAMTS18

Purification: Affinity purified

Immunogen: ADAMTS18 antibody was raised using the N terminal of ADAMTS18 corresponding to a region with amino acids FYQGFIRNDSSSSVAVSTCAGLSGLIRTRKNEFLISPLPQLLAQEHNYSS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADAMTS18 Blocking Peptide, catalog no. 33R-3140, is also available for use as a blocking control in assays to test for specificity of this ADAMTS18 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAMTS18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADAMTS18

Target: ADAMTS18 (ADAM Metallopeptidase with thrombospondin Type 1 Motif, 18 (ADAMTS18))

Alternative Name: ADAMTS18 (ADAMTS18 Products)

Synonyms: 9630038L21 antibody, ADAMTS21 antibody, E130314N14Rik antibody, KNO2 antibody, RGD1560118 antibody, a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 18 antibody, ADAM metallopeptidase with thrombospondin type 1 motif 18 antibody, ADAM metallopeptidase with thrombospondin type 1 motif, 18 antibody, Adamts18 antibody, ADAMTS18 antibody

Background: ADAMTS18 is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains.

Molecular Weight: 104 kDa (MW of target protein)