KHDRBS3 antibody (C-Term)

Catalog No. ABIN633183

Product Details anti-KHDRBS3 Antibody

Target: KHDRBS3 (KH Domain Containing, RNA Binding, Signal Transduction Associated 3 (KHDRBS3))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KHDRBS3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: KHDRBS3 antibody was raised against the C terminal of KHDRBS3

Purification: Affinity purified

Immunogen: KHDRBS3 antibody was raised using the C terminal of KHDRBS3 corresponding to a region with amino acids EQSYDSYDNSYSTPAQSGADYYDYGHGLSEETYDSYGQEEWTNSRHKAPS

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KHDRBS3 Blocking Peptide, catalog no. 33R-2680, is also available for use as a blocking control in assays to test for specificity of this KHDRBS3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHDRBS3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KHDRBS3

Target: KHDRBS3 (KH Domain Containing, RNA Binding, Signal Transduction Associated 3 (KHDRBS3))

Alternative Name: KHDRBS3 (KHDRBS3 Products)

Synonyms: KHDRBS3 antibody, T-STAR antibody, Etle antibody, SALP antibody, SLM-2 antibody, SLM2 antibody, TSTAR antibody, etoile antibody, Slm2 antibody, KH domain containing, RNA binding, signal transduction associated 3 antibody, KH RNA binding domain containing, signal transduction associated 3 antibody, KHDRBS3 antibody, Khdrbs3 antibody

Background: As a RNA-binding protein, KHDRBS3 plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. KHDRBS3 may play a role as a negative regulator of cell growth. It inhibits cell proliferation and involved in splice site selection of vascular endothelial growth factor. It induces an increased concentration-dependent incorporation of exon in CD44 pre-mRNA by direct binding to purine-rich exonic enhancer. RNA-binding abilities are down-regulated by tyrosine kinase PTK6. It also involved in post-transcriptional regulation of HIV-1 gene expression.

Molecular Weight: 38 kDa (MW of target protein)