RECQL5 antibody (Middle Region)

Catalog No. ABIN633185

Product Details anti-RECQL5 Antibody

Target: RECQL5 (RecQ Protein-Like 5 (RECQL5))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RECQL5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RecQL5 antibody was raised against the middle region of RECQL5

Purification: Affinity purified

Immunogen: RecQL5 antibody was raised using the middle region of RECQL5 corresponding to a region with amino acids CDHCQNPTAVRRRLEALERSSSWSKTCIGPSQGNGFDPELYEGGRKGYGD

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RecQL5 Blocking Peptide, catalog no. 33R-1661, is also available for use as a blocking control in assays to test for specificity of this RecQL5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RECQL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RECQL5

Target: RECQL5 (RecQ Protein-Like 5 (RECQL5))

Alternative Name: RecQL5 (RECQL5 Products)

Synonyms: RecQ5 antibody, DKFZp459N0627 antibody, recq5 antibody, RECQ5 antibody, Recq5b antibody, Recql5b antibody, RecQ like helicase 5 antibody, RecQ helicase-like 5 antibody, ATP-dependent DNA helicase Q5 antibody, RecQ protein-like 5 antibody, RECQL5 antibody, recql5 antibody, LOC100544199 antibody, Recql5 antibody

Background: RECQL5 may have an important role in DNA metabolism.

Molecular Weight: 109 kDa (MW of target protein)