SUPV3L1 antibody
-
- Target See all SUPV3L1 Antibodies
- SUPV3L1 (Suppressor of Var1, 3-Like 1 (SUPV3L1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SUPV3L1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SUPV3 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QGPSADGDVGAELTRPLDKNEVKKVLDKFYKRKEIQKLGADYGLDARLFH
- Top Product
- Discover our top product SUPV3L1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SUPV3L1 Blocking Peptide, catalog no. 33R-7571, is also available for use as a blocking control in assays to test for specificity of this SUPV3L1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SUPV0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SUPV3L1 (Suppressor of Var1, 3-Like 1 (SUPV3L1))
- Alternative Name
- SUPV3L1 (SUPV3L1 Products)
- Synonyms
- SUV3 antibody, 6330443E10Rik antibody, wu:fc19b02 antibody, wu:fe37e06 antibody, Suv3 like RNA helicase antibody, suppressor of var1, 3-like 1 (S. cerevisiae) antibody, SUV3-like helicase antibody, SUPV3L1 antibody, Supv3l1 antibody, supv3l1 antibody
- Background
- SUPV3L1 is an ATPase and DNA/RNA helicase able to unwind DNA/DNA, DNA/RNA and RNA/RNA duplexes in the 5'-3' direction. SUPV3L1 may protect cells from apoptosis.
- Molecular Weight
- 88 kDa (MW of target protein)
-