HELLS antibody (Middle Region)

Catalog No. ABIN633220

Product Details anti-HELLS Antibody

Target: HELLS (Helicase, Lymphoid-Specific (HELLS))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HELLS antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HELLS antibody was raised against the middle region of HELLS

Purification: Affinity purified

Immunogen: HELLS antibody was raised using the middle region of HELLS corresponding to a region with amino acids QSGLNLSKNFLDPKELMELLKSRDYEREIKGSREKVISDKDLELLLDRSD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HELLS Blocking Peptide, catalog no. 33R-7725, is also available for use as a blocking control in assays to test for specificity of this HELLS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HELLS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HELLS

Target: HELLS (Helicase, Lymphoid-Specific (HELLS))

Alternative Name: HELLS (HELLS Products)

Synonyms: HELLS antibody, cb65 antibody, pasg antibody, sb:cb65 antibody, sb:cb749 antibody, im:6911667 antibody, AI323785 antibody, E130115I21Rik antibody, LSH antibody, Lysh antibody, PASG antibody, YFK8 antibody, Tbc1d12 antibody, SMARCA6 antibody, lsh antibody, nbla10143 antibody, smarca6 antibody, helicase, lymphoid-specific antibody, helicase, lymphoid specific antibody, helicase, lymphoid specific L homeolog antibody, HELLS antibody, hells antibody, Hells antibody, hells.L antibody

Background: HELLS is a lymphoid-specific helicase. Other helicases function in processes involving DNA strand separation, including replication, repair, recombination, and transcription. This protein is thought to be involved with cellular proliferation and may play a role in leukemogenesis.

Molecular Weight: 92 kDa (MW of target protein)

Pathways: Chromatin Binding