SNRPD2 antibody (N-Term)

Catalog No. ABIN633239

Product Details anti-SNRPD2 Antibody

Target: SNRPD2 (Small Nuclear Ribonucleoprotein D2 Polypeptide 16.5kDa (SNRPD2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNRPD2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SNRPD2 antibody was raised against the N terminal of SNRPD2

Purification: Affinity purified

Immunogen: SNRPD2 antibody was raised using the N terminal of SNRPD2 corresponding to a region with amino acids MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SNRPD2 Blocking Peptide, catalog no. 33R-6463, is also available for use as a blocking control in assays to test for specificity of this SNRPD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SNRPD2

Target: SNRPD2 (Small Nuclear Ribonucleoprotein D2 Polypeptide 16.5kDa (SNRPD2))

Alternative Name: SNRPD2 (SNRPD2 Products)

Synonyms: SMD2 antibody, SNRPD1 antibody, Sm-D2 antibody, sm-d2 antibody, smd2 antibody, snrpd1 antibody, 170.t00019 antibody, NCU03778.1 antibody, 1810009A06Rik antibody, im:6908977 antibody, si:dkey-113g17.2 antibody, zgc:110732 antibody, small nuclear ribonucleoprotein D2 polypeptide antibody, small nuclear ribonucleoprotein D2 polypeptide L homeolog antibody, small nuclear ribonucleoprotein Sm D2 antibody, small nuclear ribonucleoprotein sm D2 antibody, small nuclear ribonucleoprotein sm d2 antibody, small nuclear ribonucleoprotein D2 antibody, SNRPD2 antibody, snrpd2 antibody, snrpd2.L antibody, EHI_108640 antibody, NCU03778 antibody, PVX_002615 antibody, SMP4 antibody, EDI_187160 antibody, LOC100036587 antibody, Snrpd2 antibody

Background: SNRPD2 belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 13 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization