XPOT antibody

Catalog No. ABIN633241

Product Details anti-XPOT Antibody

Target: XPOT (Exportin, tRNA (Nuclear Export Receptor For TRNAs) (XPOT))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This XPOT antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: XPOT antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLSDQQKANVEAIMLAVMKKLTYDEEYNFENEGEDEAMFVEYRKQLKLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

XPOT Blocking Peptide, catalog no. 33R-9364, is also available for use as a blocking control in assays to test for specificity of this XPOT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XPOT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for XPOT

Target: XPOT (Exportin, tRNA (Nuclear Export Receptor For TRNAs) (XPOT))

Alternative Name: XPOT (XPOT Products)

Synonyms: 110.t00019 antibody, XPO3 antibody, Exportin-T antibody, si:ch211-286m4.4 antibody, exportin-T antibody, 1110004L07Rik antibody, 3110065H13Rik antibody, AI452076 antibody, C79645 antibody, EXPORTIN-T antibody, exportin T antibody, exportin for tRNA antibody, exportin, tRNA (nuclear export receptor for tRNAs) antibody, EHI_029040 antibody, XPOT antibody, Xpot antibody, xpot antibody

Background: XPOT belonging to the RAN-GTPase exportin family that mediates export of tRNA from the nucleus to the cytoplasm. Translocation of tRNA to the cytoplasm occurs once exportin has bound both tRNA and GTP-bound RAN.

Molecular Weight: 110 kDa (MW of target protein)