DHX15 antibody

Catalog No. ABIN633262

Product Details anti-DHX15 Antibody

Target: DHX15 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 15 (DHX15))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DHX15 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DHX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids GHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DHX15 Blocking Peptide, catalog no. 33R-3317, is also available for use as a blocking control in assays to test for specificity of this DHX15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DHX15

Target: DHX15 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 15 (DHX15))

Alternative Name: DHX15 (DHX15 Products)

Synonyms: DBP1 antibody, DDX15 antibody, HRH2 antibody, PRP43 antibody, PRPF43 antibody, PrPp43p antibody, im:2639158 antibody, wu:fb38f09 antibody, wu:fk62f05 antibody, DDBDRAFT_0186395 antibody, DDBDRAFT_0233403 antibody, DDB_0186395 antibody, DDB_0233403 antibody, Ddx15 antibody, mDEAH9 antibody, DHX15 antibody, DEAH-box helicase 15 antibody, DEAH (Asp-Glu-Ala-His) box helicase 15 antibody, DEAH-box helicase 15 L homeolog antibody, DEAD/DEAH box helicase antibody, DEAH (Asp-Glu-Ala-His) box polypeptide 15 antibody, DHX15 antibody, dhx15 antibody, dhx15.L antibody, Dhx15 antibody

Background: DHX15 is a putative ATP-dependent RNA helicase implicated in pre-mRNA splicing.

Molecular Weight: 91 kDa (MW of target protein)