INTS6 antibody (C-Term)

Catalog No. ABIN633264

Product Details anti-INTS6 Antibody

Target: INTS6 (Integrator Complex Subunit 6 (INTS6))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This INTS6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: INTS6 antibody was raised against the C terminal of INTS6

Purification: Affinity purified

Immunogen: INTS6 antibody was raised using the C terminal of INTS6 corresponding to a region with amino acids GFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

INTS6 Blocking Peptide, catalog no. 33R-3261, is also available for use as a blocking control in assays to test for specificity of this INTS6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INTS6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for INTS6

Target: INTS6 (Integrator Complex Subunit 6 (INTS6))

Alternative Name: INTS6 (INTS6 Products)

Synonyms: DBI-1 antibody, DDX26 antibody, DDX26A antibody, DICE1 antibody, HDB antibody, INT6 antibody, Notchl2 antibody, EIF3-P48 antibody, EIF3S6 antibody, eIF3-p46 antibody, 2900075H24Rik antibody, AI480962 antibody, Ddx26 antibody, Notch2l antibody, LRRGT00024 antibody, ints6 antibody, zgc:63527 antibody, INTS6 antibody, ints6-b antibody, Int6-A antibody, dbi-1 antibody, ddx26 antibody, ddx26a antibody, dice1 antibody, hdb antibody, int6 antibody, ints6-a antibody, notchl2 antibody, integrator complex subunit 6 antibody, eukaryotic translation initiation factor 3 subunit E antibody, integrator complex subunit 6 like antibody, integrator complex subunit 6 S homeolog antibody, integrator complex subunit 6 L homeolog antibody, INTS6 antibody, EIF3E antibody, Ints6 antibody, ints6l antibody, ints6 antibody, ints6.S antibody, Tsp_09465 antibody, LOC100164318 antibody, ints6.L antibody

Background: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. INTS6 is a DEAD box protein that is part of a complex that interacts with the C-terminus of RNA polymerase II and is involved in 3' end processing of snRNAs. In addition, this gene is a candidate tumor suppressor and located in the critical region of loss of heterozygosity (LOH).

Molecular Weight: 99 kDa (MW of target protein)