DDX24 antibody

Catalog No. ABIN633266

Product Details anti-DDX24 Antibody

Target: DDX24 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 24 (DDX24))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDX24 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DDX24 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDX24 Blocking Peptide, catalog no. 33R-2570, is also available for use as a blocking control in assays to test for specificity of this DDX24 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDX24

Target: DDX24 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 24 (DDX24))

Alternative Name: DDX24 (DDX24 Products)

Synonyms: DDX24 antibody, DKFZp459P2030 antibody, 1700055J08Rik antibody, 2510027P10Rik antibody, AI649272 antibody, DEAD-box helicase 24 antibody, DEAD-box helicase 24 L homeolog antibody, DEAD (Asp-Glu-Ala-Asp) box helicase 24 antibody, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 24 antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 24 antibody, Ddx24 antibody, ddx24.L antibody, DDX24 antibody, ddx24 antibody, Chro.80030 antibody

Background: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation.

Molecular Weight: 96 kDa (MW of target protein)