RTCD1 antibody (N-Term)

Catalog No. ABIN633294

Product Details anti-RTCD1 Antibody

Target: RTCD1 (RNA terminal Phosphate Cyclase Domain 1 (RTCD1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RTCD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RTCD1 antibody was raised against the N terminal of RTCD1

Purification: Affinity purified

Immunogen: RTCD1 antibody was raised using the N terminal of RTCD1 corresponding to a region with amino acids VQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGSTEITFTPEKIK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RTCD1 Blocking Peptide, catalog no. 33R-9747, is also available for use as a blocking control in assays to test for specificity of this RTCD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTCD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RTCD1

Target: RTCD1 (RNA terminal Phosphate Cyclase Domain 1 (RTCD1))

Alternative Name: RTCD1 (RTCD1 Products)

Synonyms: Dmel\\CG4061 antibody, EG:22E5.3 antibody, RTC1_DROME antibody, DKFZp469J2025 antibody, cb158 antibody, rtcd1 antibody, sb:cb158 antibody, wu:fc62c03 antibody, zgc:56339 antibody, RTCD1 antibody, RPC antibody, RTC1 antibody, 2310009A18Rik antibody, AI450277 antibody, Rtcd1 antibody, RNA 3'-terminal phosphate cyclase antibody, Rtca antibody, RTCA antibody, rtca antibody, rtca.L antibody

Background: RNA 3-prime-terminal phosphate cyclase catalyzes the ATP-dependent conversion of a 3-prime phosphate to a 2-prime,3-prime-cyclic phosphodiester at the end of RNA.

Molecular Weight: 39 kDa (MW of target protein)