SEPSECS antibody (N-Term)

Catalog No. ABIN633298

Product Details anti-SEPSECS Antibody

Target: SEPSECS (Sep (O-phosphoserine) tRNA:Sec (Selenocysteine) tRNA Synthase (SEPSECS))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SEPSECS antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: SLA/LP antibody was raised against the N terminal of SLA/LP

Characteristics: Rabbit polyclonal SLA/LP antibody raised against the N terminal of SLA/LP

Purification: Affinity purified

Immunogen: SLA/LP antibody was raised using the N terminal of SLA/LP corresponding to a region with amino acids MDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKAAG

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLA/LP Blocking Peptide, catalog no. 33R-5871, is also available for use as a blocking control in assays to test for specificity of this SLA/LP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLA/LP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SEPSECS

Target: SEPSECS (Sep (O-phosphoserine) tRNA:Sec (Selenocysteine) tRNA Synthase (SEPSECS))

Alternative Name: SLA/LP (SEPSECS Products)

Synonyms: LP antibody, PCH2D antibody, SLA antibody, SLA/LP antibody, 9130208G10 antibody, AA986712 antibody, D5Ertd135e antibody, SecS antibody, sla/lpl antibody, zgc:55980 antibody, sepsecs antibody, Sep (O-phosphoserine) tRNA:Sec (selenocysteine) tRNA synthase antibody, Sep (O-phosphoserine) tRNA:Sec (selenocysteine) tRNA synthase L homeolog antibody, SEPSECS antibody, Sepsecs antibody, sepsecs antibody, sepsecs.L antibody

Target Type: Antibody

Background: SLA/LP converts O-phosphoseryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec) required for selenoprotein biosynthesis.

Molecular Weight: 49 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome