UPF3A antibody
-
- Target See all UPF3A Antibodies
- UPF3A (UPF3 Regulator of Nonsense Transcripts Homolog A (UPF3A))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UPF3A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- UPF3 A antibody was raised using a synthetic peptide corresponding to a region with amino acids QRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAPG
- Top Product
- Discover our top product UPF3A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
UPF3A Blocking Peptide, catalog no. 33R-7719, is also available for use as a blocking control in assays to test for specificity of this UPF3A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UPF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UPF3A (UPF3 Regulator of Nonsense Transcripts Homolog A (UPF3A))
- Alternative Name
- UPF3A (UPF3A Products)
- Synonyms
- 2600001C03Rik antibody, 4930546M19Rik antibody, RENT3A antibody, UPF3 antibody, UPF3A antibody, HUPF3A antibody, si:dkey-21o13.6 antibody, UPF3 regulator of nonsense transcripts homolog A (yeast) antibody, UPF3A, regulator of nonsense mediated mRNA decay antibody, Upf3a antibody, UPF3A antibody, upf3a antibody
- Background
- UPF3A is part of a multiprotein post-splicing mRNP complex involved in both mRNA nuclear export and mRNA surveillance. UPF3A is involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons.
- Molecular Weight
- 55 kDa (MW of target protein)
-