APOBEC1 antibody (N-Term)

Catalog No. ABIN633309

Product Details anti-APOBEC1 Antibody

Target: APOBEC1 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide 1 (APOBEC1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This APOBEC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ApoBEC1 antibody was raised against the N terminal of APOBEC1

Purification: Affinity purified

Immunogen: ApoBEC1 antibody was raised using the N terminal of APOBEC1 corresponding to a region with amino acids TSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ApoBEC1 Blocking Peptide, catalog no. 33R-9281, is also available for use as a blocking control in assays to test for specificity of this ApoBEC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for APOBEC1

Target: APOBEC1 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide 1 (APOBEC1))

Alternative Name: ApoBEC1 (APOBEC1 Products)

Synonyms: APOBEC-1 antibody, BEDP antibody, CDAR1 antibody, HEPR antibody, Cdar1 antibody, REPR antibody, APOBEC1 antibody, apolipoprotein B mRNA editing enzyme catalytic subunit 1 antibody, apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1 antibody, APOBEC1 antibody, Apobec1 antibody

Background: APOBEC1 is a member of the cytidine deaminase enzyme family. The protein forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs.

Molecular Weight: 28 kDa (MW of target protein)