THO Complex 3 antibody (Middle Region)
-
- Target See all THO Complex 3 (THOC3) Antibodies
- THO Complex 3 (THOC3)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This THO Complex 3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- THOC3 antibody was raised against the middle region of THOC3
- Purification
- Affinity purified
- Immunogen
- THOC3 antibody was raised using the middle region of THOC3 corresponding to a region with amino acids LWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLPND
- Top Product
- Discover our top product THOC3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
THOC3 Blocking Peptide, catalog no. 33R-5554, is also available for use as a blocking control in assays to test for specificity of this THOC3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THOC3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- THO Complex 3 (THOC3)
- Alternative Name
- THOC3 (THOC3 Products)
- Synonyms
- THOC3 antibody, zgc:100815 antibody, THO3 antibody, hTREX45 antibody, 2410044K02Rik antibody, AL033344 antibody, THO complex 3 antibody, THO complex subunit 3 antibody, THOC3 antibody, thoc3 antibody, LOC100400596 antibody, Thoc3 antibody
- Background
- THOC3 is part of the TREX (transcription/export) complex, which includes THO2, HPR1, ALY, and UAP56.
- Molecular Weight
- 39 kDa (MW of target protein)
-