U2AF1 antibody (N-Term)

Catalog No. ABIN633390

Product Details anti-U2AF1 Antibody

Target: U2AF1 (U2 Small Nuclear RNA Auxiliary Factor 1 (U2AF1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This U2AF1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: U2 AF1 antibody was raised against the N terminal of U2 F1

Purification: Affinity purified

Immunogen: U2 AF1 antibody was raised using the N terminal of U2 F1 corresponding to a region with amino acids MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

U2AF1 Blocking Peptide, catalog no. 33R-5649, is also available for use as a blocking control in assays to test for specificity of this U2AF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of U0 F1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for U2AF1

Target: U2AF1 (U2 Small Nuclear RNA Auxiliary Factor 1 (U2AF1))

Alternative Name: U2AF1 (U2AF1 Products)

Synonyms: DDBDRAFT_0218665 antibody, DDBDRAFT_0233354 antibody, DDB_0218665 antibody, DDB_0233354 antibody, 2010107D16Rik antibody, 35kDa antibody, FP793 antibody, RN antibody, RNU2AF1 antibody, U2AF35 antibody, U2AFBP antibody, CHUNP6860 antibody, zgc:111896 antibody, U2 small nuclear RNA auxiliary factor 1 antibody, CCHC-type zinc finger-containing protein antibody, splicing factor U2AF 35 kDa subunit antibody, U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 1 antibody, U2 small nuclear RNA auxiliary factor 1 S homeolog antibody, U2AF1 antibody, u2af1 antibody, LOC737227 antibody, U2af1 antibody, u2af1.S antibody

Background: This gene belongs to the splicing factor SR family of genes. U2 auxiliary factor, comprising a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site.

Molecular Weight: 28 kDa (MW of target protein)