RPS7 antibody (N-Term)

Catalog No. ABIN633403

Product Details anti-RPS7 Antibody

Target: RPS7 (Ribosomal Protein S7 (RPS7))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPS7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RPS7 antibody was raised against the N terminal of RPS7

Purification: Affinity purified

Immunogen: RPS7 antibody was raised using the N terminal of RPS7 corresponding to a region with amino acids MFSSSAKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLRELNITAAKE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPS7 Blocking Peptide, catalog no. 33R-6006, is also available for use as a blocking control in assays to test for specificity of this RPS7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPS7

Target: RPS7 (Ribosomal Protein S7 (RPS7))

Alternative Name: RPS7 (RPS7 Products)

Synonyms: CG1883 antibody, Dmel\\CG1883 antibody, DBA8 antibody, S7 antibody, Mtu antibody, Rps7A antibody, zgc:73216 antibody, dba8 antibody, rpS8B antibody, rpS8A antibody, Ribosomal protein S7 antibody, 30S ribosomal protein S7 antibody, 40S ribosomal protein S7 antibody, ribosomal protein S7 antibody, ribosomal protein S7 S homeolog antibody, ribosomal protein S8 antibody, RpS7 antibody, rps7 antibody, rps-7 antibody, RPS7 antibody, Rps7 antibody, rps7.S antibody

Background: RPS7 is required for rRNA maturation.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S7E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Molecular Weight: 22 kDa (MW of target protein)

Pathways: Tube Formation