POLDIP3 antibody
-
- Target See all POLDIP3 Antibodies
- POLDIP3 (Polymerase (DNA-Directed), delta Interacting Protein 3 (POLDIP3))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This POLDIP3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- POLDIP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DAITAYKKYNNRCLDGQPMKCNLHMNGNVITSDQPILLRLSDSPSMKKES
- Top Product
- Discover our top product POLDIP3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
POLDIP3 Blocking Peptide, catalog no. 33R-1855, is also available for use as a blocking control in assays to test for specificity of this POLDIP3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLDIP3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- POLDIP3 (Polymerase (DNA-Directed), delta Interacting Protein 3 (POLDIP3))
- Alternative Name
- POLDIP3 (POLDIP3 Products)
- Synonyms
- PDIP46 antibody, SKAR antibody, 1110008P04Rik antibody, AA408269 antibody, AL022852 antibody, C77954 antibody, mKIAA1649 antibody, polymerase (DNA-directed), delta interacting protein 3 S homeolog antibody, DNA polymerase delta interacting protein 3 antibody, polymerase (DNA-directed), delta interacting protein 3 antibody, poldip3.S antibody, POLDIP3 antibody, Poldip3 antibody
- Background
- POLDIP3 is a protein that interacts with the DNA polymerase delta p50 subunit. This protein is a specific target of S6 kinase 1 and regulates cell growth. Two transcript variants that encode different protein isoforms have been identified.
- Molecular Weight
- 46 kDa (MW of target protein)
-