POLDIP3 antibody

Catalog No. ABIN633420

Product Details anti-POLDIP3 Antibody

Target: POLDIP3 (Polymerase (DNA-Directed), delta Interacting Protein 3 (POLDIP3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This POLDIP3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: POLDIP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DAITAYKKYNNRCLDGQPMKCNLHMNGNVITSDQPILLRLSDSPSMKKES

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

POLDIP3 Blocking Peptide, catalog no. 33R-1855, is also available for use as a blocking control in assays to test for specificity of this POLDIP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLDIP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for POLDIP3

Target: POLDIP3 (Polymerase (DNA-Directed), delta Interacting Protein 3 (POLDIP3))

Alternative Name: POLDIP3 (POLDIP3 Products)

Synonyms: PDIP46 antibody, SKAR antibody, 1110008P04Rik antibody, AA408269 antibody, AL022852 antibody, C77954 antibody, mKIAA1649 antibody, polymerase (DNA-directed), delta interacting protein 3 S homeolog antibody, DNA polymerase delta interacting protein 3 antibody, polymerase (DNA-directed), delta interacting protein 3 antibody, poldip3.S antibody, POLDIP3 antibody, Poldip3 antibody

Background: POLDIP3 is a protein that interacts with the DNA polymerase delta p50 subunit. This protein is a specific target of S6 kinase 1 and regulates cell growth. Two transcript variants that encode different protein isoforms have been identified.

Molecular Weight: 46 kDa (MW of target protein)